Proteintech, 25557-1-AP, LIX1L Polyclonal antibody

Size: 20ul / 150ul The LIX1L (25557-1-AP) by Proteintech is a Polyclonal antibody targeting LIX1L in WB, IF/ICC, ELISA applications with reactivity to human samples 25557-1-AP targets LIX1L in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, SH-SY5Y cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Limb expression 1-like protein (LIX1L) is a putative RNA binding protein that contains a double-stranded RNA-binding motif. LIX1L is highly expressed in various cancer tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22209 Product name: Recombinant human LIX1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC035727 Sequence: METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGAAGSPAVLREAVEAVVRSFAKHTQGYGRVNVVE Predict reactive species Full Name: Lix1 homolog (mouse)-like Calculated Molecular Weight: 337 aa, 37 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC035727 Gene Symbol: LIX1L Gene ID (NCBI): 128077 RRID: AB_3669484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.