Iright
BRAND / VENDOR: Proteintech

Proteintech, 25559-1-AP, PNLDC1 Polyclonal antibody

CATALOG NUMBER: 25559-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PNLDC1 (25559-1-AP) by Proteintech is a Polyclonal antibody targeting PNLDC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25559-1-AP targets PNLDC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PNLDC1, also named as Poly(A)-specific ribonuclease PARN-like domain-containing protein 1, is a 520 amino acid protein, which belongs to the CAF1 family. PNLDC1 as a membrane protein localizes in the membrane. Specification Tested Reactivity: human, mouse Cited Reactivity: human, silkworm Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22074 Product name: Recombinant human PNLDC1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 19-371 aa of BC112246 Sequence: EFTGLRSNLSGPQQISLFDLPSEWYLKTRQSVQQFTVCQIGLSVFSAIEGEANKYIAHSCNFYLFPTTFGILDSEFSFQASSVQFLNQYGFNYNKFLKNGIPYMNEEQEKKIRHDILTGNWRVRSSPDKDQIKVVIDEVTRWLELAKEGDWMTLPGITGFQAFEVQLVLRQALPNIWTVLKDEGVVVKKVSKQHRWYLQNTSCDRESCWKENILLSARGFSVFFQMLVKAQKPLVGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPTKNSGPEIVHASRCEKYVETKCPHEAAYDAFLCGSVLLKVAHLLLQ Predict reactive species Full Name: poly(A)-specific ribonuclease (PARN)-like domain containing 1 Calculated Molecular Weight: 520 aa, 60 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC112246 Gene Symbol: PNLDC1 Gene ID (NCBI): 154197 RRID: AB_2880131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA58 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924