Iright
BRAND / VENDOR: Proteintech

Proteintech, 25560-1-AP, Marapsin2/PRSS38 Polyclonal antibody

CATALOG NUMBER: 25560-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Marapsin2/PRSS38 (25560-1-AP) by Proteintech is a Polyclonal antibody targeting Marapsin2/PRSS38 in WB, IHC, ELISA applications with reactivity to human samples 25560-1-AP targets Marapsin2/PRSS38 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, human testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PRSS38, also known as Marapsin-2, belongs to the peptidase S1 family and is expressed specifically in the testis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22191 Product name: Recombinant human MPN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-225 aa of BC130400 Sequence: IYDMYVGLVNLRVDGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEVQLPLILEPWCHLLYGHMSYIM Predict reactive species Full Name: marapsin 2 Calculated Molecular Weight: 326 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC130400 Gene Symbol: MPN2 Gene ID (NCBI): 339501 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A1L453 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924