Proteintech, 25561-1-AP, IMUP Polyclonal antibody

Size: 20ul / 150ul The IMUP (25561-1-AP) by Proteintech is a Polyclonal antibody targeting IMUP in WB, ELISA applications with reactivity to human samples 25561-1-AP targets IMUP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: EC109 cells, A549 cells, SGC-7901 cells, HeLa cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Immortalization up-regulated protein (IMUP), also known as C19orf33 or H2RSP, was first identified in SV40-immortalized fibroblasts and includes two isoforms, IMUP-1 and IMUP-2 (PMID: 14981917; 35142956). It is found primarily in the nucleus (PMID: 11606055). IMUP is reportedly upregulated in many cancer cells and tissues and its overexpression is associated with tumorigenicity and cell-cycle acceleration (PMID: 16962562; 35142956; 22886722). This polyclonal antibody raised against 1-106 aa of human IMUP can recognize both IMUP-1 and IMUP-2. The apparent molecular determined by SDS-PAGE might be due to post-translational modifications or anomalous migration behavior (PMID: 11080599). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22218 Product name: Recombinant human C19orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC060319 Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM Predict reactive species Full Name: chromosome 19 open reading frame 33 Calculated Molecular Weight: 106 aa, 11 kDa Observed Molecular Weight: 20 kDa, 22 kDa GenBank Accession Number: BC060319 Gene Symbol: IMUP Gene ID (NCBI): 64073 RRID: AB_3669485 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9GZP8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.