Proteintech, 25576-1-AP, C2orf79/PTRHD1 Polyclonal antibody

Size: 20ul / 150ul The C2orf79/PTRHD1 (25576-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf79/PTRHD1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 25576-1-AP targets C2orf79/PTRHD1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22255 Product name: Recombinant human C2orf79 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC073803 Sequence: MHRGVGPAFRVVRKMAASGAEPQVLVQYLVLRKDLSQAPFSWPAGALVAQACHAATAALHTHRDHPHTAAYLQELGRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK Predict reactive species Full Name: chromosome 2 open reading frame 79 Calculated Molecular Weight: 140 aa, 16 kDa Observed Molecular Weight: 13-16 kDa GenBank Accession Number: BC073803 Gene Symbol: PTRHD1 Gene ID (NCBI): 391356 RRID: AB_2880136 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6GMV3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.