Proteintech, 25583-1-AP, C13orf30 Polyclonal antibody

Size: 20ul / 150ul The C13orf30 (25583-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf30 in IHC, IF/ICC, ELISA applications with reactivity to human, canine samples 25583-1-AP targets C13orf30 in IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MDCK cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22353 Product name: Recombinant human C13orf30 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-139 aa of BC093659 Sequence: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIYNSRPQWEALQTRYIHSLQHQQLLGYITQREALSYALVLRDSTKRASAKVAPQRTIPRKTSAMTRRCPSVLPVSVVLPRAQSKRRQVLRN Predict reactive species Full Name: chromosome 13 open reading frame 30 Calculated Molecular Weight: 139 aa, 16 kDa GenBank Accession Number: BC093659 Gene Symbol: C13orf30 Gene ID (NCBI): 144809 RRID: AB_2880139 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N7L0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.