Iright
BRAND / VENDOR: Proteintech

Proteintech, 25590-1-AP, PRDM15 Polyclonal antibody

CATALOG NUMBER: 25590-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PRDM15 (25590-1-AP) by Proteintech is a Polyclonal antibody targeting PRDM15 in WB, IP, ELISA applications with reactivity to human samples 25590-1-AP targets PRDM15 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells Positive IP detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The PR-domain containing proteins (PRDMs) have a common involvement in the modulation of gene activities. A PR-domain family member usually produces two products, called PR-plus and PR-minus, which differ by the presence or absence of the PR domain, respectively. The PR-plus product is underexpressed or disrupted in cancer cells, whereas the PR-minus product is present or overexpressed in cancer cells. This imbalance in the amount of the two products, which is a result of either genetic or epigenetic events, appears to be a determining factor of malignancy. PRDM15 (PR domain-containing protein 15), also known as PFM15 or ZNF298, is a 1507 amino acid protein belonging to the PRDM family. Localizing to the nucleus, PRDM15 contains sixteen C2H2-type zinc fingers and one SET domain. It is believed to participate in transcriptional regulation and may be involved in cell differentiation and tumorigenesis. PRDM15 exists several isoform and molecular weight of respective isoform is 169 kDa, 135kda, 62kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22296 Product name: Recombinant human PRDM15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 791-1141 aa of BC067102 Sequence: KHCKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQPELTLEQEDLAEGKHGKAAKRSHKRKQKPEEEAGAPVPEDATFSEYSEKETEFTGSVGDETNSAVQSIQQVVVTLGDPNVTTPSSSVGLTNITVTPITTAAATQFTNLQPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDVQIHPQPEASNPQSVAHFINLTTLVNSITPLGSQLSDQHPLTWRAVPQTDVLPPPQPQAPPQQAAQPQVQAEQQQQQMYSY Predict reactive species Full Name: PR domain containing 15 Calculated Molecular Weight: 1507 aa, 169 kDa Observed Molecular Weight: 169 kDa GenBank Accession Number: BC067102 Gene Symbol: PRDM15 Gene ID (NCBI): 63977 RRID: AB_2880145 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57071 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924