Iright
BRAND / VENDOR: Proteintech

Proteintech, 25592-1-AP, ZNF549 Polyclonal antibody

CATALOG NUMBER: 25592-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF549 (25592-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF549 in WB, IF/ICC, ELISA applications with reactivity to human samples 25592-1-AP targets ZNF549 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells, A549 cells, HeLa cells, SMMC-7721 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information ZNF549 (zinc finger protein 549), belonging to the kruppel C2H2-type zinc-finger protein family, is a 640 amino acid nuclear protein that exists as 2 alternatively spliced isoforms and may be involved in transcriptional regulation in cancer disease. Overexpression of ZNF549 inhibit the ability of COAD cell proliferation and migration (PMID: 33028966). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22371 Product name: Recombinant human ZNF549 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 109-236 aa of BC060863 Sequence: CILVMKDILYLSEHQGTLPWQKPYTSVASGKWFSFGSNLQQHQNQDSGEKHIRKEESSALLLNSCKIPLSDNLFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFNEKVHVTE Predict reactive species Full Name: zinc finger protein 549 Calculated Molecular Weight: 640 aa, 74 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC060863 Gene Symbol: ZNF549 Gene ID (NCBI): 256051 RRID: AB_2880147 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P9A3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924