Iright
BRAND / VENDOR: Proteintech

Proteintech, 25598-1-AP, NFU1 Polyclonal antibody

CATALOG NUMBER: 25598-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NFU1 (25598-1-AP) by Proteintech is a Polyclonal antibody targeting NFU1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 25598-1-AP targets NFU1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, mouse brain tissue, mouse testis tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information NFU1, also named as HIRA-interacting protein 5 or CGI-33, is a 254 amino acid protein, which belongs to the NifU family. NFU1 localizes in the Mitochondrion. NFU1 is widely expressed in adult tissues. NFU1, as an Iron-sulfur cluster scaffold protein, which can assemble clusters and deliver them to target proteins. It has an association with Multiple mitochondrial dysfunctions syndrome 1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22343 Product name: Recombinant human NFU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC113692 Sequence: MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP Predict reactive species Full Name: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Calculated Molecular Weight: 254 aa, 28 kDa Observed Molecular Weight: 23-28 kDa GenBank Accession Number: BC113692 Gene Symbol: NFU1 Gene ID (NCBI): 27247 RRID: AB_2880151 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UMS0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924