Proteintech, 25604-1-AP, Znt5 Polyclonal antibody

Size: 20ul / 150ul The Znt5 (25604-1-AP) by Proteintech is a Polyclonal antibody targeting Znt5 in IHC, IP, ELISA applications with reactivity to human, mouse samples 25604-1-AP targets Znt5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse liver tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12947 Product name: Recombinant human SLC30A5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC000808 Sequence: MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN Predict reactive species Full Name: solute carrier family 30 (zinc transporter), member 5 Calculated Molecular Weight: 84 kDa Observed Molecular Weight: 84-87 kDa GenBank Accession Number: BC000808 Gene Symbol: Znt5 Gene ID (NCBI): 64924 RRID: AB_2880155 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAD4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.