Iright
BRAND / VENDOR: Proteintech

Proteintech, 25622-1-AP, BHLHE22 Polyclonal antibody

CATALOG NUMBER: 25622-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BHLHE22 (25622-1-AP) by Proteintech is a Polyclonal antibody targeting BHLHE22 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25622-1-AP targets BHLHE22 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information Basic helix-loop-helix family member e22 (BHLHE22), a basic helix loop helix transcription factor family member, acts as a transcriptional repressor and has a role in cell differentiation in neuron development (PMID: 36941015). BHLHE22 expression serves as a potential biomarker for ICI treatment prediction and favorable prognosis, and that is associated with microenvironment immune status (PMID: 35806162). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20966 Product name: Recombinant human BHLHE22 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-225 aa of BC156671 Sequence: MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG Predict reactive species Full Name: basic helix-loop-helix family, member e22 Calculated Molecular Weight: 381 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC156671 Gene Symbol: BHLHE22 Gene ID (NCBI): 27319 RRID: AB_2880165 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924