Proteintech, 25635-1-AP, ZNF322A Polyclonal antibody

Size: 20ul / 150ul The ZNF322A (25635-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF322A in WB, ELISA applications with reactivity to human, mouse, rat samples 25635-1-AP targets ZNF322A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Zinc finger protein ZNF322A is an oncogenic transcription factor. Overexpression of ZNF322A activates pro-metastasis, cancer stemness, and neo-angiogenesis-related genes to enhance lung cancer progression. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22406 Product name: Recombinant human ZNF322A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 320-402 aa of BC050425 Sequence: PHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSFHQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS Predict reactive species Full Name: zinc finger protein 322A Calculated Molecular Weight: 402 aa, 47 kDa Observed Molecular Weight: 46-52 kDa GenBank Accession Number: BC050425 Gene Symbol: ZNF322A Gene ID (NCBI): 79692 RRID: AB_3669490 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6U7Q0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.