Iright
BRAND / VENDOR: Proteintech

Proteintech, 25649-1-AP, TNFAIP2 Polyclonal antibody

CATALOG NUMBER: 25649-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TNFAIP2 (25649-1-AP) by Proteintech is a Polyclonal antibody targeting TNFAIP2 in WB, ELISA applications with reactivity to human samples 25649-1-AP targets TNFAIP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TNFAIP2, also named as B94, belongs to the SEC6 family. TNFAIP2 may play a role as a mediator of inflammation and angiogenesis. TNFAIP2 is differentially expressed in development and capillary tube-like formation in vitro. It is induced by TNFα and other proinflammatory factors. Specification Tested Reactivity: human Cited Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19150 Product name: Recombinant human TNFAIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 88-431 aa of BC128449 Sequence: RQIRLLEATFLSSEAANVRELMDRALELEARRWAEDVPPQRLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRANVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSHGFDTLLQNLHEDLKPLFKRFTHTRWAAPVETLENIIATVDTRLPEFSELQGCFREELMEALHLHLVKEYIIQLSKGRLVLKTAEQQQQLAGYILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSLIKVG Predict reactive species Full Name: tumor necrosis factor, alpha-induced protein 2 Calculated Molecular Weight: 654 aa, 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC128449 Gene Symbol: TNFAIP2 Gene ID (NCBI): 7127 RRID: AB_2918092 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03169 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924