Proteintech, 25651-1-AP, C11orf83 Polyclonal antibody

Size: 20ul / 150ul The C11orf83 (25651-1-AP) by Proteintech is a Polyclonal antibody targeting C11orf83 in IHC, ELISA applications with reactivity to human samples 25651-1-AP targets C11orf83 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22442 Product name: Recombinant human C11orf83 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-94 aa of BC090057 Sequence: VIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATTQENVAWRKNWMVGGEGGASGRSP Predict reactive species Full Name: chromosome 11 open reading frame 83 Calculated Molecular Weight: 93 aa, 10 kDa GenBank Accession Number: BC090057 Gene Symbol: C11orf83 Gene ID (NCBI): 790955 RRID: AB_2880176 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UW78 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.