Proteintech, 25671-1-AP, CHCHD10 Polyclonal antibody

Size: 20ul / 150ul The CHCHD10 (25671-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD10 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications with reactivity to human, mouse, rat samples 25671-1-AP targets CHCHD10 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, HAP1, mouse heart tissue, rat heart tissue Positive IP detected in: mouse heart tissue, HAP1 cells Positive IHC detected in: human kidney tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HAP1 Positive CoIP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Co-Immunoprecipitation (CoIP): COIP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information CHCHD10 is a mitochondrial protein that is enriched at cristae junctions in the intermembrane space and is likely involved in mitochondrial genome stability and maintenance of cristae junctions. Mutations in CHCHD10 have recently been described as a cause of frontotemporal dementia (FTD) comorbid with amyotrophic lateral sclerosis (ALS). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22598 Product name: Recombinant human CHCHD10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-142 aa of BC065232 Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP Predict reactive species Full Name: coiled-coil-helix-coiled-coil-helix domain containing 10 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC065232 Gene Symbol: CHCHD10 Gene ID (NCBI): 400916 RRID: AB_2880187 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WYQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.