Iright
BRAND / VENDOR: Proteintech

Proteintech, 25674-1-AP, GGA1 Polyclonal antibody

CATALOG NUMBER: 25674-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GGA1 (25674-1-AP) by Proteintech is a Polyclonal antibody targeting GGA1 in WB, IF/ICC, ELISA applications with reactivity to human, rat, mouse samples 25674-1-AP targets GGA1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, rat brain tissue, HeLa cells, SH-SY5Y cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22614 Product name: Recombinant human GGA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 276-395 aa of BC044629 Sequence: ALGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPE Predict reactive species Full Name: golgi associated, gamma adaptin ear containing, ARF binding protein 1 Observed Molecular Weight: 70-72 kDa GenBank Accession Number: BC044629 Gene Symbol: GGA1 Gene ID (NCBI): 26088 RRID: AB_2880188 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924