Iright
BRAND / VENDOR: Proteintech

Proteintech, 25679-1-AP, GATAD2B Polyclonal antibody

CATALOG NUMBER: 25679-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GATAD2B (25679-1-AP) by Proteintech is a Polyclonal antibody targeting GATAD2B in WB, IF/ICC, ELISA applications with reactivity to human samples 25679-1-AP targets GATAD2B in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells, PC-3 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22615 Product name: Recombinant human GATAD2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-170 aa of BC069419 Sequence: MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLR Predict reactive species Full Name: GATA zinc finger domain containing 2B Observed Molecular Weight: 69 kDa GenBank Accession Number: BC069419 Gene Symbol: GATAD2B Gene ID (NCBI): 57459 RRID: AB_2880190 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXI9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924