Proteintech, 25685-1-AP, RNFT2 Polyclonal antibody

Size: 20ul / 150ul The RNFT2 (25685-1-AP) by Proteintech is a Polyclonal antibody targeting RNFT2 in WB, ELISA applications with reactivity to human samples 25685-1-AP targets RNFT2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, SMMC-7721 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22313 Product name: Recombinant human RNFT2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 139-231 aa of BC011878 Sequence: LYVLYTFSSEIAPQHSNLGDRVSETLSKKKKKERREGGRKEGRKERKKAQLWPRCGYPLVSCLYVFLLFLFCHLPHLSLRPVSSSCGHCHPLW Predict reactive species Full Name: ring finger protein, transmembrane 2 Calculated Molecular Weight: 444 aa, 49 kDa Observed Molecular Weight: 49-59 kDa GenBank Accession Number: BC011878 Gene Symbol: RNFT2 Gene ID (NCBI): 84900 RRID: AB_2880194 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EX2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.