Iright
BRAND / VENDOR: Proteintech

Proteintech, 25692-1-AP, BAIAP2L1 Polyclonal antibody

CATALOG NUMBER: 25692-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BAIAP2L1 (25692-1-AP) by Proteintech is a Polyclonal antibody targeting BAIAP2L1 in WB, IHC, ELISA applications with reactivity to human samples 25692-1-AP targets BAIAP2L1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SGC-7901 cells, K-562 cells Positive IHC detected in: human ovary tumor tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BAIAP2L1, also known as IRTKS, is a 511-amino acid protein containing an IRSp53/MIM homology domain (IMD) that bundles actin filaments and interacts with the small GTPase Rac (PMID: 17430976; 14752106). In addition to the IMD domain, BAIAP2L1 also contains an SH3 domain and WW domain interaction motif. BAIAP2L1 is widely distributed and is an INS receptor substrate. It has a role in actin remodeling and membrane protrusion. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22499 Product name: Recombinant human BAIAP2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-388 aa of BC013888 Sequence: DKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKA Predict reactive species Full Name: BAI1-associated protein 2-like 1 Calculated Molecular Weight: 511 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC013888 Gene Symbol: BAIAP2L1 Gene ID (NCBI): 55971 RRID: AB_2880197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHR4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924