Iright
BRAND / VENDOR: Proteintech

Proteintech, 25693-1-AP, ATAD4 / PRR15L Polyclonal antibody

CATALOG NUMBER: 25693-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATAD4 / PRR15L (25693-1-AP) by Proteintech is a Polyclonal antibody targeting ATAD4 / PRR15L in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25693-1-AP targets ATAD4 / PRR15L in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ATAD4 (ATPase family AAA domain-containing protein 4), also known as PRR15L (Proline Rich 15 Like), and its function has not yet been discovered. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22500 Product name: Recombinant human ATAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-71 aa of BC002865 Sequence: MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVS Predict reactive species Full Name: ATPase family, AAA domain containing 4 Calculated Molecular Weight: 103 aa, 12 kDa GenBank Accession Number: BC002865 Gene Symbol: ATAD4 Gene ID (NCBI): 79170 RRID: AB_3085816 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BU68 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924