Proteintech, 25706-1-AP, C17orf64 Polyclonal antibody

Size: 20ul / 150ul The C17orf64 (25706-1-AP) by Proteintech is a Polyclonal antibody targeting C17orf64 in WB, ELISA applications with reactivity to human, mouse samples 25706-1-AP targets C17orf64 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CHCT1 (CHD1 helical C-terminal domain-containing protein 1), also called C17orf64, may play a role in the regulation of apoptosis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22769 Product name: Recombinant human C17orf64 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC048806 Sequence: MLWRFISLFSELEAKQLRRLYKYTKSSQPAKFLVTFCASDAPERSLLADREDSLPKLCHAWGLHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETEP Predict reactive species Full Name: chromosome 17 open reading frame 64 Calculated Molecular Weight: 236 aa, 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC048806 Gene Symbol: C17orf64 Gene ID (NCBI): 124773 RRID: AB_3669495 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.