Proteintech, 25708-1-AP, KK-LC-1 Polyclonal antibody

Size: 20ul / 150ul The KK-LC-1 (25708-1-AP) by Proteintech is a Polyclonal antibody targeting KK-LC-1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25708-1-AP targets KK-LC-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human placenta tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KK-LC-1 has been described as kita-kyushu lung cancer antigen 1, cancer/testis antigen 83. Therefore, KK-LC-1 is also known as CXorf61 and CT83. KK-LC-1 has been tested for association to diseases, such as adenocarcinoma and lung neoplasms. The molecular mass of KK-LC-1 is 13 kDa. Studies have shown that KK-LC-1 is an ideal target for immunotherapy of triple-negative breast cancer (TNBC) (PMID: 26327325). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22619 Product name: Recombinant human CXorf61 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-113 aa of BC062223 Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST Predict reactive species Full Name: chromosome X open reading frame 61 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC062223 Gene Symbol: KK-LC-1 Gene ID (NCBI): 203413 RRID: AB_2880203 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5H943 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.