Iright
BRAND / VENDOR: Proteintech

Proteintech, 25742-1-AP, ZMYM3 Polyclonal antibody

CATALOG NUMBER: 25742-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZMYM3 (25742-1-AP) by Proteintech is a Polyclonal antibody targeting ZMYM3 in WB, IP, ELISA applications with reactivity to human, mouse samples 25742-1-AP targets ZMYM3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: K-562 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ZMYM3, also named as DXS6673E, KIAA0385, and ZNF261, is a 1370 amino acid protein, which may be a component of a BHC histone deacetylase complex. ZMYM3 is most abundant in brain, moderate in muscle and heart, low in other tissues except placenta. ZMYM3 plays a role in the regulation of cell morphology and cytoskeletal organization. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22701 Product name: Recombinant human ZMYM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-317 aa of BC013009 Sequence: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQTPEVVPPDPGAGANSCSPEGLLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELPQGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRSERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVSQRAGRSAVGTKMTCAHCRTP Predict reactive species Full Name: zinc finger, MYM-type 3 Calculated Molecular Weight: 1370 aa, 152 kDa Observed Molecular Weight: 190-200 kDa GenBank Accession Number: BC013009 Gene Symbol: ZMYM3 Gene ID (NCBI): 9203 RRID: AB_2880221 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14202 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924