Proteintech, 25752-1-AP, COX20 Polyclonal antibody

Size: 20ul / 150ul The COX20 (25752-1-AP) by Proteintech is a Polyclonal antibody targeting COX20 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 25752-1-AP targets COX20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Positive IHC detected in: human prostate cancer tissue, human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information COX20, also name as FAM36A, belongs to the COX20 family. Mutations in COX20 are a novel cause of recessively inherited. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22520 Product name: Recombinant human FAM36A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC018519 Sequence: MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN Predict reactive species Full Name: family with sequence similarity 36, member A Calculated Molecular Weight: 118 aa, 13 kDa Observed Molecular Weight: ~16 kDa GenBank Accession Number: BC018519 Gene Symbol: COX20 Gene ID (NCBI): 116228 RRID: AB_2880224 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5RI15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.