Product Description
Size: 20ul / 150ul
The SNX32 (25763-1-AP) by Proteintech is a Polyclonal antibody targeting SNX32 in WB, IHC, ELISA applications with reactivity to human, mouse samples
25763-1-AP targets SNX32 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells, L02 cells
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
Sorting nexins are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif PX domain (PMID:12461558). They are involved in endocytosis and protein trafficking. SNX32 (Sorting nexin-32, also known as SNX6B) may be involved in several stages of intracellular trafficking.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human, pig
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22653 Product name: Recombinant human SNX32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 218-285 aa of BC040981 Sequence: HTRIRDACLRADRVMRAHKCLADDYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVVSDE Predict reactive species
Full Name: sorting nexin 32
Calculated Molecular Weight: 46 kDa
Observed Molecular Weight: 46 kDa
GenBank Accession Number: BC040981
Gene Symbol: SNX32
Gene ID (NCBI): 254122
RRID: AB_2880229
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q86XE0
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924