Proteintech, 25766-1-AP, ORAI3 Polyclonal antibody

Size: 20ul / 150ul The ORAI3 (25766-1-AP) by Proteintech is a Polyclonal antibody targeting ORAI3 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25766-1-AP targets ORAI3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, BxPC-3 cells, LNCaP cells, PC-3 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ORAI3, also named TMEM142C, is a key regulator or component of store-operated Ca2+ channels and transcription factor NFAT nuclear import. ORAI3 channels appeared to differ from Orai1 and -2 in being somewhat resistant to Ca2+ depotentiation. The molecular weight of monomers and dimers for Orai3 is about 30-35 kDa and 60-70 kDa (PMID: 20971921; 17293345; 22580508). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22513 Product name: Recombinant human ORAI3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of BC006126 Sequence: MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSA Predict reactive species Full Name: ORAI calcium release-activated calcium modulator 3 Calculated Molecular Weight: 295 aa, 32 kDa Observed Molecular Weight: ~30 kDa, 60 kDa GenBank Accession Number: BC006126 Gene Symbol: ORAI3 Gene ID (NCBI): 93129 RRID: AB_2880231 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.