Proteintech, 25771-1-AP, G6PC Polyclonal antibody

Size: 20ul / 150ul The G6PC (25771-1-AP) by Proteintech is a Polyclonal antibody targeting G6PC in WB, ELISA applications with reactivity to human, rat samples 25771-1-AP targets G6PC in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver, the kidney cortex, and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240). The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400). Specification Tested Reactivity: human, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22683 Product name: Recombinant human G6PC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC136369 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLL Predict reactive species Full Name: glucose-6-phosphatase, catalytic subunit Observed Molecular Weight: 42 kDa GenBank Accession Number: BC136369 Gene Symbol: G6PC Gene ID (NCBI): 2538 RRID: AB_3669498 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35575 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.