Proteintech, 25797-1-AP, ZNF649 Polyclonal antibody

Size: 20ul / 150ul The ZNF649 (25797-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF649 in WB, ELISA applications with reactivity to human, mouse samples 25797-1-AP targets ZNF649 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZNF649, also named as Zinc finger protein 649, is a 505 amino acid protein, which contains The one KRAB domain and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF649 is highly expressed in heart, skeletal muscle, and brain and lower expression in liver, lung, kidney, pancreas and placenta. ZNF649 as a regulator of transcriptional factor complexes may suppress SRE and AP-1 transcription activities by growth factor signaling pathways. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22700 Product name: Recombinant human ZNF649 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 66-183 aa of BC005368 Sequence: LWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFLKHQQTHNIEKAHECTDC Predict reactive species Full Name: zinc finger protein 649 Calculated Molecular Weight: 505 aa, 58 kDa Observed Molecular Weight: 50-57 kDa GenBank Accession Number: BC005368 Gene Symbol: ZNF649 Gene ID (NCBI): 65251 RRID: AB_2880241 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BS31 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.