Iright
BRAND / VENDOR: Proteintech

Proteintech, 25801-1-AP, HNF4G Polyclonal antibody

CATALOG NUMBER: 25801-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HNF4G (25801-1-AP) by Proteintech is a Polyclonal antibody targeting HNF4G in WB, IHC, ELISA applications with reactivity to human, mouse samples 25801-1-AP targets HNF4G in WB, IHC, IF, chIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse kidney tissue Positive IHC detected in: rat small intestine tissue, mouse small intestine tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information HNF4 (hepatocyte nuclear factor 4) is a nuclear receptor protein that has a critical role in hepatocyte differentiation and function (PMID: 12774000). Two isoforms of human HNF4 exist, HNF4-alpha and HNF4-gamma, which are encoded by two separate genes HNF4A and HNF4G respectively (PMID: 7926813). HNF4-gamma has a lower transcription activation potential than HNF4-alpha. HNF4-gamma is expressed in kidney, gut, pancreas, and testis (PMID: 16945327). It has been reported to be involved in cancer progression (PMID: 23896584). This polyclonal antibody is raised against C-terminal 82 amino acids of human HNF4-gamma. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22848 Product name: Recombinant human HNF4G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 327-408 aa of BC105009 Sequence: GGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL Predict reactive species Full Name: hepatocyte nuclear factor 4, gamma Calculated Molecular Weight: 445 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC105009 Gene Symbol: HNF4G Gene ID (NCBI): 3174 RRID: AB_2880242 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14541 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924