Product Description
Size: 20ul / 150ul
The A1CF (25812-1-AP) by Proteintech is a Polyclonal antibody targeting A1CF in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
25812-1-AP targets A1CF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse liver tissue
Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
A1CF, also known as Apobec-1 complementation factor, is an RNA-binding protein that plays a crucial role in the post-transcriptional editing of apolipoprotein B (apoB) mRNA. It is a component of the enzyme complex responsible for converting a CAA codon for glutamine to a UAA stop codon in apoB mRNA, resulting in the production of a truncated protein, apoB48, instead of the full-length apoB100.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22929 Product name: Recombinant human A1CF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC054873 Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR Predict reactive species
Full Name: APOBEC1 complementation factor
Calculated Molecular Weight: 594 aa, 65 kDa
Observed Molecular Weight: 65 kDa
GenBank Accession Number: BC054873
Gene Symbol: A1CF
Gene ID (NCBI): 29974
RRID: AB_3669501
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NQ94
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924