Proteintech, 25816-1-AP, FAM125A Polyclonal antibody

Size: 20ul / 150ul The FAM125A (25816-1-AP) by Proteintech is a Polyclonal antibody targeting FAM125A in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 25816-1-AP targets FAM125A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information FAM125A, also named as MVB12A and CFBP, is a component of the ESCRT-I complex. FAM125A is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. FAM125A has three isoforms with MW 27-28 kDa and 25 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22919 Product name: Recombinant human FAM125A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC007883 Sequence: MDPVPGTDSAPLAGLAWSSASAPPPRGFSAISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPLGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTLRRNDSIYEASSLYGISA Predict reactive species Full Name: family with sequence similarity 125, member A Calculated Molecular Weight: 273 aa, 29 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC007883 Gene Symbol: FAM125A Gene ID (NCBI): 93343 RRID: AB_2880250 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.