Proteintech, 25833-1-AP, DEPP Polyclonal antibody

Size: 20ul / 150ul The DEPP (25833-1-AP) by Proteintech is a Polyclonal antibody targeting DEPP in WB, ELISA applications with reactivity to human samples 25833-1-AP targets DEPP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information DEPP, also named as FIG and C10orf10, is known to be differentially regulated in mouse tissues in response to hypoxia and oxidative stress. Moreover, Studies have reported that DEPP1 is one of the early adipogenic markers (PMID:36918557). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22773 Product name: Recombinant human C10orf10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-212 aa of BC011402 Sequence: MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL Predict reactive species Full Name: chromosome 10 open reading frame 10 Calculated Molecular Weight: 212 aa, 23 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC011402 Gene Symbol: DEPP Gene ID (NCBI): 11067 RRID: AB_2880260 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NTK1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.