Iright
BRAND / VENDOR: Proteintech

Proteintech, 25842-1-AP, ROR2 Polyclonal antibody

CATALOG NUMBER: 25842-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ROR2 (25842-1-AP) by Proteintech is a Polyclonal antibody targeting ROR2 in WB, ELISA applications with reactivity to human samples 25842-1-AP targets ROR2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, T-47D cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Tyrosine-protein kinase transmembrane receptor ROR2 belongs to the ROR-family of receptor tyrosine kinases (RTKs) (PMID: 12815588). ROR2 is a developmentally regulated protein that has significant expression and roles in a wide variety of tissues during early embryonic development. It was established that ROR2 plays a key role in skeletal and neural organogenesis, as well as in midgut development in the mouse, but then becomes repressed in adult tissues. It may act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling (PMID: 25614331). Mutations in ROR2 gene are associated with autosomal recessive Robinow syndrome and autosomal dominant brachydactyly type B (PMID: 12815588). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22959 Product name: Recombinant human ROR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 781-943 aa of BC130522 Sequence: VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA Predict reactive species Full Name: receptor tyrosine kinase-like orphan receptor 2 Calculated Molecular Weight: 943 aa, 105 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC130522 Gene Symbol: ROR2 Gene ID (NCBI): 4920 RRID: AB_2918094 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01974 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924