Iright
BRAND / VENDOR: Proteintech

Proteintech, 25846-1-AP, AVEN Polyclonal antibody

CATALOG NUMBER: 25846-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AVEN (25846-1-AP) by Proteintech is a Polyclonal antibody targeting AVEN in WB, IHC, ELISA applications with reactivity to human samples 25846-1-AP targets AVEN in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, K-562 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AVEN (Apoptosis caspase activation inhibitor) is known to play a role in male and female germ cell development. AVEN protein has also been shown to inhibit the mitochondrial apoptosis pathway by binding to and inhibiting the self-association of proapoptotic APAF-1, as well as binding to and enhancing antiapoptotic BCL-xL activity. AVEN has also recently been shown to function as an activator of the cell cycle-regulating ATM kinase in the DNA damage response pathway. Molecular weight of this protein detected by WB is 50 kDa (PMID: 22751129). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23020 Product name: Recombinant human AVEN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-362 aa of BC010488 Sequence: MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS Predict reactive species Full Name: apoptosis, caspase activation inhibitor Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC010488 Gene Symbol: AVEN Gene ID (NCBI): 57099 RRID: AB_2880266 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQS1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924