Proteintech, 25869-1-AP, c-Met (Cytoplasmic) Polyclonal antibody

Size: 20ul / 150ul The c-Met (Cytoplasmic) (25869-1-AP) by Proteintech is a Polyclonal antibody targeting c-Met (Cytoplasmic) in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat, canine samples 25869-1-AP targets c-Met (Cytoplasmic) in WB, IHC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: HepG2 cells, MDCK cells Positive IP detected in: HeLa cells Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, human colon tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information c-Met (also named MET or HGFR) is a receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to the HGF ligand. c-Met regulates many physiological processes including proliferation, scattering, morphogenesis, and survival. The primary single-chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide-linked to form the mature receptor. Overexpression and/or mutation of c-Met has been reported in various human malignancies, including lung cancer, breast cancer, head and neck cancer, gastric cancer, colorectal cancer, bladder cancer, uterine cervix carcinoma, esophageal carcinoma, c-Met could serve as an important therapeutic target (PMID: 26036285). The c-met receptor is a 190-kD glycoprotein consisting of a 145-kD membrane-spanning beta chain and a 50-kD alpha chain (PMID: 7806559). In Western blot, this antibody produces bands of unknown identity at 55 and 100 kDa. Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23140 Product name: Recombinant human MET protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 965-1085 aa of BC130420 Sequence: GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG Predict reactive species Full Name: met proto-oncogene (hepatocyte growth factor receptor) Calculated Molecular Weight: 1390 aa, 155 kDa Observed Molecular Weight: 145 kDa GenBank Accession Number: BC130420 Gene Symbol: MET Gene ID (NCBI): 4233 RRID: AB_2880276 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08581 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.