Proteintech, 25891-1-AP, C9 Polyclonal antibody

Size: 20ul / 150ul The C9 (25891-1-AP) by Proteintech is a Polyclonal antibody targeting C9 in WB, ELISA applications with reactivity to human samples 25891-1-AP targets C9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information The final consequence of complement activation is the formation of the membrane attack complex (MAC), a multiprotein assembly that perforates cell membranes, forming transmembrane channels. The MAC plays a critical role in complement-mediated hemolysis and inflammasome activation (PMID: 27444648). Complement component 9 (C9) is 1 of 5 late-acting proteins of complement that participate in the assembly and function of the MAC. C9 may be cleaved by thrombin to generate fragments C9a (25 kDa) and C9b (37 kDa) (PMID: 7523406). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23137 Product name: Recombinant human C9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 22-313 aa of BC020721 Sequence: QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDV Predict reactive species Full Name: complement component 9 Calculated Molecular Weight: 559 aa, 63 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC020721 Gene Symbol: C9 Gene ID (NCBI): 735 RRID: AB_3085827 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02748 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.