Iright
BRAND / VENDOR: Proteintech

Proteintech, 25897-1-AP, KIF5C Polyclonal antibody

CATALOG NUMBER: 25897-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KIF5C (25897-1-AP) by Proteintech is a Polyclonal antibody targeting KIF5C in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 25897-1-AP targets KIF5C in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KIF5C (Kinesin heavy chain isoform 5C variant) which belongs to the kinesin-like protein family is neuron specific. The kinesin-1 subfamilies (kif5a, kif5b, kif5c) are responsible for the movement of mitochondria in neurons. Kinesins have N-terminal motor domains and C-terminal cargo-binding tail domains separated by hinge regions. The hinge and C-terminal tail regions of Kif5a, Kif5b, and Kif5c bound a large detergent-resistant RNase-sensitive granule. The granule localized to dendrites and underwent bidirectional movement. Distally directed movement of the granule was enhanced by Kif5 overexpression and reduced by Kif5 functional blockage. kinesins may transport RNA in dendrites via this large granule. Two major isoforms of kif5c, with molecular predicted masses of 80 and 110 kDa, are generated by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23163 Product name: Recombinant human KIF5C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-194 aa of BC110287 Sequence: AVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYR Predict reactive species Full Name: kinesin family member 5C Calculated Molecular Weight: 725 aa, 83 kDa Observed Molecular Weight: 70 kDa, 110 kDa GenBank Accession Number: BC110287 Gene Symbol: KIF5C Gene ID (NCBI): 3800 RRID: AB_2880288 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60282 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924