Proteintech, 25898-1-AP, CCR7 Polyclonal antibody

Size: 20ul / 150ul The CCR7 (25898-1-AP) by Proteintech is a Polyclonal antibody targeting CCR7 in WB, IHC, ELISA applications with reactivity to human, rat samples 25898-1-AP targets CCR7 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, C6 cells, K-562 cells, T-47D cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C-C chemokine receptor type 7 (CCR7), which belongs to the G-protein coupled receptor 1 family, is also a receptor for the MIP-3-beta chemokine, and probably acts as a mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions. CCR7 is specially expressed in various lymphoid tissues and activated B- and T-lymphocytes, and can be strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22941 Product name: Recombinant human CCR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 279-378 aa of BC035343 Sequence: YNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP Predict reactive species Full Name: chemokine (C-C motif) receptor 7 Calculated Molecular Weight: 378 aa, 43 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC035343 Gene Symbol: CCR7 Gene ID (NCBI): 1236 RRID: AB_2880289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32248 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.