Iright
BRAND / VENDOR: Proteintech

Proteintech, 25903-1-AP, FOXJ1 Polyclonal antibody

CATALOG NUMBER: 25903-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FOXJ1 (25903-1-AP) by Proteintech is a Polyclonal antibody targeting FOXJ1 in WB, ELISA applications with reactivity to human, mouse, rat samples 25903-1-AP targets FOXJ1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information FOXJ1 (Forkhead box protein J1) acts by activating the transcription of genes mediating motile cilia's assembly, such as CFAP157. It binds the DNA consensus sequences 5'-HWDTGTTTGTTTA-3' or 5'-KTTTGTTGTTKTW-3' (where H is not G, W is A or T, D is not C, and K is G or T), and activates the transcription of a variety of ciliary proteins in the developing brain and lung (PMID: 31630787). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20827 Product name: Recombinant human FOXJ1 protein Source: e coli. -derived, PET32a Tag: 6*His Domain: 1-421 aa of BC046460 Sequence: MAESWLRLSGAGPAEEAGPEGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGGTDPHGYHQVPGSAAPGSPLAADPACLGQPHTPGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKGNFDWEAIFDAGTLGGELGALEALELSPPLSPASHVDVDLTIHGRHIDCPATWGPSVEQAADSLDFDETFLATSFLQHPWDESGSGCLPPEPLFEAGDATLASDLQDWASVGAFL Predict reactive species Full Name: forkhead box J1 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC046460 Gene Symbol: FOXJ1 Gene ID (NCBI): 2302 RRID: AB_3669505 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92949 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924