Proteintech, 25912-1-AP, NUDT13 Polyclonal antibody

Size: 20ul / 150ul The NUDT13 (25912-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT13 in WB, ELISA applications with reactivity to human samples 25912-1-AP targets NUDT13 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MKN-45 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23186 Product name: Recombinant human NUDT13 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-263 aa of BC046173 Sequence: MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPRHSLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWFALDLGLDSSFSISASLHKPEMETELKGSFIELRKALFQLNARDASLLSTAQALLRWHDAHQFCSRSGQPTKKNVAGSKRVCPSNNIIYYPQIQVNLRELETAAWFSHDEVATALKRKGPYTQQQNGTFPFWLPPKLAISHQLIKEWVEKQTCSSLPA Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 13 Calculated Molecular Weight: 352 aa, 40 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC046173 Gene Symbol: NUDT13 Gene ID (NCBI): 25961 RRID: AB_2918097 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86X67 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.