Proteintech, 25933-1-AP, PCP4L1 Polyclonal antibody

Size: 20ul / 150ul The PCP4L1 (25933-1-AP) by Proteintech is a Polyclonal antibody targeting PCP4L1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 25933-1-AP targets PCP4L1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PCP4L1 (Purkinje cell protein 4-like 1) is a small neuronal IQ motif protein closely related to the calmodulin-binding protein Pcp4/PEP-19 (PMID: 22458599). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23061 Product name: Recombinant human PCP4L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC028905 Sequence: MSELNTKTSPATNQAAGQEEKGKAGNVKKAEEEEEIDIDLTAPETEKAALAIQGKFRRFQKRKKDPSS Predict reactive species Full Name: Purkinje cell protein 4 like 1 Calculated Molecular Weight: 68 aa, 7 kDa Observed Molecular Weight: 8-15 kDa GenBank Accession Number: BC028905 Gene Symbol: PCP4L1 Gene ID (NCBI): 654790 RRID: AB_2880301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NKN8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.