Iright
BRAND / VENDOR: Proteintech

Proteintech, 25956-1-AP, ZNF644 Polyclonal antibody

CATALOG NUMBER: 25956-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF644 (25956-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF644 in WB, ELISA applications with reactivity to human samples 25956-1-AP targets ZNF644 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Y79 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information G9a/GLP complex is associated with Polycomb Repressive Complex 2 (PRC2).The G9a/GLP complex also regulates DNA methylation during early embryogenesis, which is independent of their methyltransferase activity. ZNF644 and WIZ, two zinc finger proteins, interact with G9a and GLP, respectively. These two zinc finger proteins target G9a and GLP to genomic loci for the regulation of gene transcription. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22798 Product name: Recombinant human ZNF644 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 970-1329 aa of BC063683 Sequence: LSNHVRGHLHRAGLSYEARHVVSPEQIATSDKMQHFKRTGTGTPVKRVRKAIEKSETTSEHTCQLCGGWFDTKIGLSNHVRGHLKRLGKTKWDAHKSPICVLNEMMQNEEKYEKILKALNSRRIIPRPFVAQKLASSDDFISQNVIPLEAYRNGLKTEALSVSASEEEGLNFLNEYDETKPELPSGKKNQSLTLIELLKNKRMGEERNSAISPQKIHNQTARKRFVQKCVLPLNEDSPLMYQPQKMDLTMHSALDCKQKKSRSRSGSKKKMLTLPHGADEVYILRCRFCGLVFRGPLSVQEDWIKHLQRHIVNANLPRTGAGMVEVTSLLKKPASITETSFSLLMAEAAS Predict reactive species Full Name: zinc finger protein 644 Calculated Molecular Weight: 1327 aa, 150 kDa Observed Molecular Weight: 175 kDa GenBank Accession Number: BC063683 Gene Symbol: ZNF644 Gene ID (NCBI): 84146 RRID: AB_3669512 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H582 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924