Iright
BRAND / VENDOR: Proteintech

Proteintech, 25962-1-AP, UT-B Polyclonal antibody

CATALOG NUMBER: 25962-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UT-B (25962-1-AP) by Proteintech is a Polyclonal antibody targeting UT-B in WB, ELISA applications with reactivity to human, mouse samples 25962-1-AP targets UT-B in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse Cited Reactivity: human, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6769 Product name: Recombinant human SLC14A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-389 aa of BC050539 Sequence: LSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPWTGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGMFMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIYKMPLSKVTYPEENRIFYLQAKKRMVESPL Predict reactive species Full Name: solute carrier family 14 (urea transporter), member 1 (Kidd blood group) Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: BC050539 Gene Symbol: UT-B Gene ID (NCBI): 6563 RRID: AB_2880311 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13336 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924