Iright
BRAND / VENDOR: Proteintech

Proteintech, 25965-1-AP, CCDC106 Polyclonal antibody

CATALOG NUMBER: 25965-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC106 (25965-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC106 in WB, ELISA applications with reactivity to human samples 25965-1-AP targets CCDC106 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Coiled-coil domain containing 106 (CCDC106) is a protein containing 280 amino acids with a molecular weight of 32 kDa. The coiled-coil domain is involved in molecular recognition, DNA binding and secretion. CCDC106 was identified as a p53-interacting partner by automated yeast two-hybrid screening , but its sequence and interaction with p53 have not been further confirmed.(PMID: 35484984,PMID: 20159018) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23115 Product name: Recombinant human CCDC106 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-280 aa of BC000412 Sequence: MNDRSSRRRTMKDDETFEISIPFDEAPHLDPQIFYSLSPSRRNFEEPPEAASSALALMNSVKTQLHMALERNSWLQKRIEDLEEERDFLRCQLDKFISSARMEAEDHCRMKPGPRRMEGDSRGGAGGEASDPESAASSLSGASEEGSASERRRQKQKGGASRRRFGKPKARERQRVKDADGVLCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKERLLEYSRRCFLALDDETLKKVQALKKSKLLLPITYRFKR Predict reactive species Full Name: coiled-coil domain containing 106 Calculated Molecular Weight: 280 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000412 Gene Symbol: CCDC106 Gene ID (NCBI): 29903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924