Proteintech, 25990-1-AP, MTMR7 Polyclonal antibody

Size: 20ul / 150ul The MTMR7 (25990-1-AP) by Proteintech is a Polyclonal antibody targeting MTMR7 in WB, ELISA applications with reactivity to human, mouse, rat samples 25990-1-AP targets MTMR7 in WB, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23170 Product name: Recombinant human MTMR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 514-660 aa of BC130577 Sequence: RQSVTDYLMAVKEETQQLEEELEALEERLEKIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDYSGNMKSFPSRSPSQGDEDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFLTA Predict reactive species Full Name: myotubularin related protein 7 Observed Molecular Weight: 85 kDa GenBank Accession Number: BC130577 Gene Symbol: MTMR7 Gene ID (NCBI): 9108 RRID: AB_2880323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y216 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.