Iright
BRAND / VENDOR: Proteintech

Proteintech, 25992-1-AP, ZNF580 Polyclonal antibody

CATALOG NUMBER: 25992-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF580 (25992-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF580 in IP, ELISA applications with reactivity to human samples 25992-1-AP targets ZNF580 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: COLO 320 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ZNF580 enables sequence-specific double-stranded DNA binding activity. Involved in several processes, including cellular response to hydrogen peroxide; positive regulation of cell migration; and positive regulation of interleukin-8 production. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23313 Product name: Recombinant human ZNF580 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC017698 Sequence: MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGA Predict reactive species Full Name: zinc finger protein 580 Observed Molecular Weight: 20 kDa GenBank Accession Number: BC017698 Gene Symbol: ZNF580 Gene ID (NCBI): 51157 RRID: AB_3669515 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UK33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924