Proteintech, 25996-1-AP, GPR148 Polyclonal antibody

Size: 20ul / 150ul The GPR148 (25996-1-AP) by Proteintech is a Polyclonal antibody targeting GPR148 in IHC, ELISA applications with reactivity to human, mouse samples 25996-1-AP targets GPR148 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR148, also known as BTR or PGR6, belongs to a G protein-coupled receptor (GPCR) family. It is primarily expressed in the brain and testis, suggesting a role in specific sensory functions and possibly in reproductive processes. As a GPCR, GPR148 is likely to be involved in signal transduction pathways triggered by the binding of specific ligands, such as odorants or other small molecules. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22948 Product name: Recombinant human GPR148 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC105013 Sequence: MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLLLVTILRNQRLRQEPHYLLPANILLS Predict reactive species Full Name: G protein-coupled receptor 148 Calculated Molecular Weight: 347 aa, 38 kDa GenBank Accession Number: BC105013 Gene Symbol: GPR148 Gene ID (NCBI): 344561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.