Proteintech, 26020-1-AP, DHRS7C Polyclonal antibody

Size: 20ul / 150ul The DHRS7C (26020-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS7C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26020-1-AP targets DHRS7C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23392 Product name: Recombinant human DHRS7C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-308 aa of BC147025 Sequence: VEEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG Predict reactive species Full Name: dehydrogenase/reductase (SDR family) member 7C Observed Molecular Weight: 35 kDa GenBank Accession Number: BC147025 Gene Symbol: DHRS7C Gene ID (NCBI): 201140 RRID: AB_3085836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NNS2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.