Iright
BRAND / VENDOR: Proteintech

Proteintech, 26020-1-AP, DHRS7C Polyclonal antibody

CATALOG NUMBER: 26020-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DHRS7C (26020-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS7C in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26020-1-AP targets DHRS7C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23392 Product name: Recombinant human DHRS7C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-308 aa of BC147025 Sequence: VEEYDVVISTVSPTFIRSYHVYPEQGNWEASIWKFFFRKLTYGVHPVEVAEEVMRTVRRKKQEVFMANPIPKAAVYVRTFFPEFFFAVVACGVKEKLNVPEEG Predict reactive species Full Name: dehydrogenase/reductase (SDR family) member 7C Observed Molecular Weight: 35 kDa GenBank Accession Number: BC147025 Gene Symbol: DHRS7C Gene ID (NCBI): 201140 RRID: AB_3085836 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NNS2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924