Product Description
Size: 20ul / 150ul
The ZCCHC13 (26023-1-AP) by Proteintech is a Polyclonal antibody targeting ZCCHC13 in WB, ELISA applications with reactivity to human, mouse, rat samples
26023-1-AP targets ZCCHC13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, PC-3 cells, HepG2 cells, MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
ZCCHC13 (zinc-finger CCHC-type containing 13) is a member of a family of zinc-finger CCHC-type containing DNA/RNA-binding proteins that are involved in mRNA transcription and protein translation. Downregulation of ZCCHC13 was shown to be associated with spermatogenesis failure in patients with non-obstructive azoospermia (NOA)(PMID: 29531833). It is reported that ZCCHC13 overexpression might be related to global DNA hypomethylation and promote hepatocellular carcinoma (HCC)(PMID: 23891108).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22050 Product name: Recombinant human ZCCHC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC021176 Sequence: MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNI Predict reactive species
Full Name: zinc finger, CCHC domain containing 13
Calculated Molecular Weight: 166 aa, 18 kDa
Observed Molecular Weight: 25 kDa
GenBank Accession Number: BC021176
Gene Symbol: ZCCHC13
Gene ID (NCBI): 389874
RRID: AB_3669517
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8WW36
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924