Iright
BRAND / VENDOR: Proteintech

Proteintech, 26029-1-AP, C2orf3 Polyclonal antibody

CATALOG NUMBER: 26029-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C2orf3 (26029-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf3 in WB, ELISA applications with reactivity to human samples 26029-1-AP targets C2orf3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information GC-rich sequence DNA-binding factor is a protein that in humans is encoded by the C2orf3 gene. C2orf3 belongs to the GCF family. It is a factor that represses transcription. It binds to the GC-rich sequences present in the epidermal growth factor receptor, beta-actin, and calcium-dependent protease promoters. The MW of this protein is 89 kDa, and this antibody specially recognises the 89 kDa protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23315 Product name: Recombinant human C2orf3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC064559 Sequence: MAHRPKRTFRQRAADSSDSDGAEESPAEPGAARELPVPGSAEEEPPSGGGRAQVAGLPHRVRGPRGRGRVWASSRRATKAAPRADEGSESRTLDVSTDEEDKIHHSSESKDDQGLSSDSSSSLGEKELSSTVK Predict reactive species Full Name: chromosome 2 open reading frame 3 Observed Molecular Weight: 89 kDa GenBank Accession Number: BC064559 Gene Symbol: C2orf3 Gene ID (NCBI): 6936 RRID: AB_2880343 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16383 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924